PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MLOC_59162.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
Family NAC
Protein Properties Length: 174aa    MW: 19749.9 Da    PI: 10.4058
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MLOC_59162.2genomeIBSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM167.73.9e-5291331128
           NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkg 97 
                   lppGfrFhPtdeelv++yL+++++g ++ +  +i+e+d+yk++Pw+Lpk++  +ekewyfFs+rd+ky++g+r+nra+ sgyWkatg dk+v +   
  MLOC_59162.2   9 LPPGFRFHPTDEELVMHYLCRRCAGAPIAV-PIITEIDLYKFDPWQLPKMAMYGEKEWYFFSPRDRKYPNGSRPNRAAGSGYWKATGADKPVGT--P 102
                   79**************************99.88***************7666789*************************************99..7 PP

           NAM  98 elvglkktLvfykgrapkgektdWvmheyrl 128
                   +   +kk Lvfy g+apkgekt+W+mheyrl
  MLOC_59162.2 103 KPLAIKKALVFYAGKAPKGEKTNWIMHEYRL 133
                   789**************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.31E-575138IPR003441NAC domain
PROSITE profilePS5100554.1659154IPR003441NAC domain
PfamPF023655.0E-2710133IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009611Biological Processresponse to wounding
GO:0009788Biological Processnegative regulation of abscisic acid-activated signaling pathway
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 174 aa     Download sequence    Send to blast
MSGGQELNLP PGFRFHPTDE ELVMHYLCRR CAGAPIAVPI ITEIDLYKFD PWQLPKMAMY  60
GEKEWYFFSP RDRKYPNGSR PNRAAGSGYW KATGADKPVG TPKPLAIKKA LVFYAGKAPK  120
GEKTNWIMHE YRLADVDRSA RKKNSLRVSK PSHPCQPRFA AVIRLLVSCN KSPR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A2e-71613312140Stress-induced transcription factor NAC1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00121DAPTransfer from AT1G01720Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3628920.0AK362892.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2010O18.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003564785.11e-102PREDICTED: NAC domain-containing protein 48
SwissprotQ7F2L31e-103NAC48_ORYSJ; NAC domain-containing protein 48
TrEMBLM0XDQ61e-128M0XDQ6_HORVD; Uncharacterized protein
STRINGMLOC_59162.11e-105(Hordeum vulgare)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G01720.12e-92NAC family protein